PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008432m
Common NameEUTSA_v10008428mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 279aa    MW: 31045.3 Da    PI: 10.271
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008432mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind355.51.2e-10812781301
        GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllall 85 
                      mdddg+  rn+gyyepa a++k nlglqlmssi +r++k+    r+ nl ++++++++++ +    m++    +++++       +++k++++l
  Thhalv10008432m   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSSI-DRNTKPflpgRDPNL-MIGSNGSYHHPEppihMSY----NWINQ-------QKDKFFNML 79 
                      99**99..9*******999**************.9**************.**********995555555....*****.......899****** PP

        GAGA_bind  86 lvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvk 179
                      +v+++     +++ +vl++t+s+ s+q+    +l     + ++++++e++p+++++e +++kk+k++++ ++ +k+kk +k+k+++  s+++++
  Thhalv10008432m  80 PVTTT-----SHYGNVLPETSSAPSMQM----NL----HNHHHHHQTEVNPVKCEEEIVQTKKRKSNSKAGTATKAKKPRKPKEEN--SNNNNN 158
                      *9997.....56788*************....34....34455688999*****99999999999999999************954..444445 PP

        GAGA_bind 180 kesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLa 273
                      ++   +r+k  kks+dlv+ngvs+D+s+lPvP+C+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa
  Thhalv10008432m 159 TSV--SRVKPAKKSVDLVINGVSMDISGLPVPICTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLA 250
                      555..689************************************************************************************** PP

        GAGA_bind 274 aeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      ++G++++np+DLk+hWA+HGtnkfvtir
  Thhalv10008432m 251 SDGFNFGNPIDLKSHWARHGTNKFVTIR 278
                      ***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.2E-1691278IPR010409GAGA-binding transcriptional activator
PfamPF062178.0E-991278IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMSS IDRNTKPFLP GRDPNLMIGS NGSYHHPEPP  60
IHMSYNWINQ QKDKFFNMLP VTTTSHYGNV LPETSSAPSM QMNLHNHHHH HQTEVNPVKC  120
EEEIVQTKKR KSNSKAGTAT KAKKPRKPKE ENSNNNNNTS VSRVKPAKKS VDLVINGVSM  180
DISGLPVPIC TCTGAPQQCY RWGCGGWQSA CCTTNISMHP LPMSTKRRGA RISGRKMSQG  240
AFKKVLEKLA SDGFNFGNPI DLKSHWARHG TNKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416987.10.0hypothetical protein EUTSA_v10008428mg
RefseqXP_006416988.10.0hypothetical protein EUTSA_v10008428mg
SwissprotQ9LDE21e-177BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLV4MTY30.0V4MTY3_EUTSA; Uncharacterized protein
STRINGBra016686.1-P1e-176(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-163basic pentacysteine 2